RNPC2 monoclonal antibody (M01), clone 4G8
  • RNPC2 monoclonal antibody (M01), clone 4G8

RNPC2 monoclonal antibody (M01), clone 4G8

Ref: AB-H00009584-M01
RNPC2 monoclonal antibody (M01), clone 4G8

Información del producto

Mouse monoclonal antibody raised against a partial recombinant RNPC2.
Información adicional
Size 100 ug
Gene Name RBM39
Gene Alias CAPER|CAPERalpha|CC1.3|DKFZp781C0423|FLJ44170|HCC1|RNPC2|fSAP59
Gene Description RNA binding motif protein 39
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,WB-Re,IHC-P,S-ELISA,ELISA,IF
Immunogen Prot. Seq TQCFQLSNMFNPQTEEEVGWDTEIKDDVIEECNKHGGVIHIYVDKNSAQG
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RNPC2 (NP_909122, 423 a.a. ~ 472 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9584
Clone Number 4G8
Iso type IgG2a Kappa

Enviar un mensaje


RNPC2 monoclonal antibody (M01), clone 4G8

RNPC2 monoclonal antibody (M01), clone 4G8