ENTPD4 purified MaxPab mouse polyclonal antibody (B01P)
  • ENTPD4 purified MaxPab mouse polyclonal antibody (B01P)

ENTPD4 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00009583-B01P
ENTPD4 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human ENTPD4 protein.
Información adicional
Size 50 ug
Gene Name ENTPD4
Gene Alias KIAA0392|LALP70|LAP70|LYSAL1|NTPDase-4|UDPase
Gene Description ectonucleoside triphosphate diphosphohydrolase 4
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MGRIGISCLFPASWHFSISPVGCPRILNTNLRQIMVISVLAAAVSLLYFSVVIIRNKYGRLTRDKKFQRYLARVTDIEATDTNNPNVNYGIVVDCGSSGSRVFVYCWPRHNGNPHDLLDIRQMRDKNRKPVVMKIKPGISEFATSPEKVSDYISPLLNFAAEHVPRAKHKETPLYILCTAGMRILPESQQKAILEDLLTDIPVHFDFLFSDSHAEVISGKQEGVYAWIGINFVLGRFEHIEDDDEAVVEVNIPGS
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ENTPD4 (AAH34477.1, 1 a.a. ~ 571 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9583

Enviar un mensaje


ENTPD4 purified MaxPab mouse polyclonal antibody (B01P)

ENTPD4 purified MaxPab mouse polyclonal antibody (B01P)