SOX13 purified MaxPab rabbit polyclonal antibody (D01P)
  • SOX13 purified MaxPab rabbit polyclonal antibody (D01P)

SOX13 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00009580-D01P
SOX13 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human SOX13 protein.
Información adicional
Size 100 ug
Gene Name SOX13
Gene Alias ICA12|MGC117216|Sox-13
Gene Description SRY (sex determining region Y)-box 13
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MSMRSPISAQLALDGVGTMVNCTIKSEEKKEPCHEAPQGSATAAEPQPGDPARASQDSADPQAPAQGNFRGSWDCSSPEGNGSPEPKRPGVSEAASGSQEKLDFNRNLKEVVPAIEKLLSSDWKERFLGRNSMEAKDVKGTQESLAEKELQLLVMIHQLSTLRDQLLTAHSEQKNMAAMLFEKQQQQMELARQQQEQIAKQQQQLIQQQHKINLLQQQIQQVNMPYVMIPAFPPSHQPLPVTPDSQLALPIQPIP
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen SOX13 (NP_005677.2, 1 a.a. ~ 622 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9580

Enviar un mensaje


SOX13 purified MaxPab rabbit polyclonal antibody (D01P)

SOX13 purified MaxPab rabbit polyclonal antibody (D01P)