CDC42BPB monoclonal antibody (M02), clone 6G3
  • CDC42BPB monoclonal antibody (M02), clone 6G3

CDC42BPB monoclonal antibody (M02), clone 6G3

Ref: AB-H00009578-M02
CDC42BPB monoclonal antibody (M02), clone 6G3

Información del producto

Mouse monoclonal antibody raised against a partial recombinant CDC42BPB.
Información adicional
Size 100 ug
Gene Name CDC42BPB
Gene Alias KIAA1124|MRCKB
Gene Description CDC42 binding protein kinase beta (DMPK-like)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,IHC-P,S-ELISA,ELISA
Immunogen Prot. Seq SKMISNPTNFNHVAHMGPGDGMQVLMDLPLSAVPPSQEERPGPAPTNLARQPPSRNKPYISWPSSGGSEPSVTVPLRSMSDPDQDFDKEPDSDSTKHSTP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CDC42BPB (AAD37506, 1580 a.a. ~ 1679 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9578
Clone Number 6G3
Iso type IgG2a Kappa

Enviar un mensaje


CDC42BPB monoclonal antibody (M02), clone 6G3

CDC42BPB monoclonal antibody (M02), clone 6G3