SPAG6 purified MaxPab rabbit polyclonal antibody (D01P)
  • SPAG6 purified MaxPab rabbit polyclonal antibody (D01P)

SPAG6 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00009576-D01P
SPAG6 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human SPAG6 protein.
Información adicional
Size 100 ug
Gene Name SPAG6
Gene Alias DKFZp434I153|MGC26276|Repro-SA-1|pf16
Gene Description sperm associated antigen 6
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MSQRQVLQVFEQYQKARTQFVQMVAELATRPQNIETLQNAGVMSLLRTLLLDVVPTIQQTAALALGRLANYNDDLAEAVVKCDILPQLVYSLAEQNRFYKKAAAFVLRAVGKHSPQLAQAIVDCGALDTLVICLEDFDPGVKEAAAWALRYIARHNAELSQAVVDAGAVPLLVLCIQEPEIALKRIAASALSDIAKHSPELAQTVVDAGAVAHLAQMILNPDAKLKHQILSALSQVSKHSVDLAEMVVEAEIFPV
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen SPAG6 (NP_036575.1, 1 a.a. ~ 509 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9576

Enviar un mensaje


SPAG6 purified MaxPab rabbit polyclonal antibody (D01P)

SPAG6 purified MaxPab rabbit polyclonal antibody (D01P)