CLOCK polyclonal antibody (A01)
  • CLOCK polyclonal antibody (A01)

CLOCK polyclonal antibody (A01)

Ref: AB-H00009575-A01
CLOCK polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant CLOCK.
Información adicional
Size 50 uL
Gene Name CLOCK
Gene Alias KAT13D|KIAA0334|bHLHe8
Gene Description clock homolog (mouse)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq PVMSQATNLPIPQGMSQFQFSAQLGAMQHLKDQLEQRTRMIEANIHRQQEELRKIQEQLQMVHGQGLQMFLQQSNPGLNFGSVQLSSGNSSNIQQLAPIN
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CLOCK (NP_004889, 497 a.a. ~ 596 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 9575

Enviar un mensaje


CLOCK polyclonal antibody (A01)

CLOCK polyclonal antibody (A01)