NR1D1 monoclonal antibody (M19), clone 2A5
  • NR1D1 monoclonal antibody (M19), clone 2A5

NR1D1 monoclonal antibody (M19), clone 2A5

Ref: AB-H00009572-M19
NR1D1 monoclonal antibody (M19), clone 2A5

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant NR1D1.
Información adicional
Size 100 ug
Gene Name NR1D1
Gene Alias EAR1|THRA1|THRAL|ear-1|hRev
Gene Description nuclear receptor subfamily 1, group D, member 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq SQCPLETSPTQHPTPGPMGPSPPPAPVPSPLVGFSQFPQQLTPPRSPSPEPTVEDVISQVARAHREIFTYAHDKLGSSPGNFNANHASG
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen NR1D1 (NP_068370, 233 a.a. ~ 322 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9572
Clone Number 2A5
Iso type IgG2a Kappa

Enviar un mensaje


NR1D1 monoclonal antibody (M19), clone 2A5

NR1D1 monoclonal antibody (M19), clone 2A5