Ver mas grande
NR1D1 monoclonal antibody (M16), clone 1F4
AB-H00009572-M16
Producto nuevo
NR1D1 monoclonal antibody (M16), clone 1F4
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 100 ug |
| Gene Name | NR1D1 |
| Gene Alias | EAR1|THRA1|THRAL|ear-1|hRev |
| Gene Description | nuclear receptor subfamily 1, group D, member 1 |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Re,S-ELISA,ELISA,IF |
| Immunogen Prot. Seq | SQCPLETSPTQHPTPGPMGPSPPPAPVPSPLVGFSQFPQQLTPPRSPSPEPTVEDVISQVARAHREIFTYAHDKLGSSPGNFNANHASG |
| Antigen species Target species | Human |
| Quality control testing | Antibody Reactive Against Recombinant Protein. |
| Immunogen | NR1D1 (NP_068370, 233 a.a. ~ 322 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Storage Buffer | In 1x PBS, pH 7.4 |
| Gene ID | 9572 |
| Clone Number | 1F4 |
| Iso type | IgG2a Kappa |
Más información
Mouse monoclonal antibody raised against a full-length recombinant NR1D1.