GTPBP1 polyclonal antibody (A01)
  • GTPBP1 polyclonal antibody (A01)

GTPBP1 polyclonal antibody (A01)

Ref: AB-H00009567-A01
GTPBP1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant GTPBP1.
Información adicional
Size 50 uL
Gene Name GTPBP1
Gene Alias GP-1|GP1|HSPC018|MGC20069
Gene Description GTP binding protein 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,ELISA
Immunogen Prot. Seq MDEGCGETIYVIGQGSDGTEYGLSEADMEASYATVKSMAEQIEADVILLRERQEAGGRVRDYLVRKRVGDNDFLEV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen GTPBP1 (NP_004277, 1 a.a. ~ 76 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 9567

Enviar un mensaje


GTPBP1 polyclonal antibody (A01)

GTPBP1 polyclonal antibody (A01)