BCAR1 purified MaxPab rabbit polyclonal antibody (D01P)
  • BCAR1 purified MaxPab rabbit polyclonal antibody (D01P)

BCAR1 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00009564-D01P
BCAR1 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human BCAR1 protein.
Información adicional
Size 100 ug
Gene Name BCAR1
Gene Alias CAS|CAS1|CASS1|CRKAS|P130Cas
Gene Description breast cancer anti-estrogen resistance 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF
Immunogen Prot. Seq MNHLNVLAKALYDNVAESPDELSFRKGDIMTVLEQDTQGLDGWWLCSLHGRQGIVPGNRLKILVGMYDKKPAGPGSGPPATPAQPQPGLHAPAPPASQYTPMLPNTYQPQPDSVYLVPTPSKAQQGLYQVPGPSPQFQSPPAKQTSTFSKQTPHHPFPNPATDLYQVPPGPGGPAQDIYQVPPSAGMGHDIYQVPPSMDTRSWEGTKPPAKVVVPTRVGQGYVYEAAQPEQDEYDIPRHLLAPGPQDIYDVPPVR
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen BCAR1 (AAH62556.1, 1 a.a. ~ 870 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9564

Enviar un mensaje


BCAR1 purified MaxPab rabbit polyclonal antibody (D01P)

BCAR1 purified MaxPab rabbit polyclonal antibody (D01P)