H6PD polyclonal antibody (A01)
  • H6PD polyclonal antibody (A01)

H6PD polyclonal antibody (A01)

Ref: AB-H00009563-A01
H6PD polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant H6PD.
Información adicional
Size 50 uL
Gene Name H6PD
Gene Alias DKFZp686A01246|G6PDH|GDH|MGC87643
Gene Description hexose-6-phosphate dehydrogenase (glucose 1-dehydrogenase)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq HIGHGDLGSPAVLVSRNLFRPSLPSSWKEMEGPPGLRLFGSPLSDYYAYSPVRERDAHSVLLSHIFHGRKNFFITTENLLASWNFWTPLLESLAHKAPRL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen H6PD (NP_004276, 401 a.a. ~ 500 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 9563

Enviar un mensaje


H6PD polyclonal antibody (A01)

H6PD polyclonal antibody (A01)