BAG2 polyclonal antibody (A01)
  • BAG2 polyclonal antibody (A01)

BAG2 polyclonal antibody (A01)

Ref: AB-H00009532-A01
BAG2 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant BAG2.
Información adicional
Size 50 uL
Gene Name BAG2
Gene Alias BAG-2|KIAA0576|MGC149462|dJ417I1.2
Gene Description BCL2-associated athanogene 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA
Immunogen Prot. Seq RNPQQQESLKHATRIIDEVVNKFLDDLGNAKSHLMSLYSACSSEVPHGPVDQKFQSIVIGCALEDQKKIKRRLETLLRNIENSDKAIKLLEHSKGAGSKTLQQNAESRFN
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen BAG2 (NP_004273, 102 a.a. ~ 211 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 9532

Enviar un mensaje


BAG2 polyclonal antibody (A01)

BAG2 polyclonal antibody (A01)