BAG4 purified MaxPab mouse polyclonal antibody (B01P)
  • BAG4 purified MaxPab mouse polyclonal antibody (B01P)

BAG4 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00009530-B01P
BAG4 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human BAG4 protein.
Información adicional
Size 50 ug
Gene Name BAG4
Gene Alias BAG-4|SODD
Gene Description BCL2-associated athanogene 4
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr,IHC-P
Immunogen Prot. Seq MSALRRSGYGPSDGPSYGRYYGPGGGDVPVHPPPPLYPLRPEPPQPPISWRVRGGGPAETTWLGEGGGGDGYYPSGGAWPEPGRAGGSHQEQPPYPSYNSNYWNSTARSRAPYPSTYPVRPELQGQSLNSYTNGAYGPTYPPGPGANTASYSGAYYAPGYTQTSYSTEVPSTYRSSGNSPTPVSRWIYPQQDCQTEAPPLRGQVPGYPPSQNPGMTLPHYPYGDGNRSVPQSGPTVRPQEDAWASPGAYGMGGRY
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen BAG4 (NP_004865.1, 1 a.a. ~ 457 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9530

Enviar un mensaje


BAG4 purified MaxPab mouse polyclonal antibody (B01P)

BAG4 purified MaxPab mouse polyclonal antibody (B01P)