LITAF MaxPab rabbit polyclonal antibody (D01)
  • LITAF MaxPab rabbit polyclonal antibody (D01)

LITAF MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00009516-D01
LITAF MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human LITAF protein.
Información adicional
Size 100 uL
Gene Name LITAF
Gene Alias FLJ38636|MGC116698|MGC116700|MGC116701|MGC125274|MGC125275|MGC125276|PIG7|SIMPLE|TP53I7
Gene Description lipopolysaccharide-induced TNF factor
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IP
Immunogen Prot. Seq MSVPGPYQAATGPSSAPSAPPSYEETVAVNSYYPTPPAPMPGPTTGLVTGPDGKGMNPPSYYTQPAPIPNNNPITVQTVYVQHPITFLDRPIQMCCPSCNKMIVSQLSYNAGALTWLSCGSLCLLGCIAGCCFIPFCVDALQDVDHYCPNCRALLGTYKRL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen LITAF (NP_004853.2, 1 a.a. ~ 161 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 9516

Enviar un mensaje


LITAF MaxPab rabbit polyclonal antibody (D01)

LITAF MaxPab rabbit polyclonal antibody (D01)