XAGE1D monoclonal antibody (M01), clone 4D12
  • XAGE1D monoclonal antibody (M01), clone 4D12

XAGE1D monoclonal antibody (M01), clone 4D12

Ref: AB-H00009503-M01
XAGE1D monoclonal antibody (M01), clone 4D12

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant XAGE1D.
Información adicional
Size 100 ug
Gene Name XAGE1D
Gene Alias -
Gene Description X antigen family, member 1D
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MESPKKKNQQLKVGILHLGSRQKKIRIQLRSQVLGREMRDMEGDLQELHQSNTGDKSGFGFRRQGEDNT
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen XAGE1D (NP_597673.1, 1 a.a. ~ 69 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9503
Clone Number 4D12
Iso type IgG1 Kappa

Enviar un mensaje


XAGE1D monoclonal antibody (M01), clone 4D12

XAGE1D monoclonal antibody (M01), clone 4D12