PIGL monoclonal antibody (M01), clone 2B6
  • PIGL monoclonal antibody (M01), clone 2B6

PIGL monoclonal antibody (M01), clone 2B6

Ref: AB-H00009487-M01
PIGL monoclonal antibody (M01), clone 2B6

Información del producto

Mouse monoclonal antibody raised against a partial recombinant PIGL.
Información adicional
Size 100 ug
Gene Name PIGL
Gene Alias -
Gene Description phosphatidylinositol glycan anchor biosynthesis, class L
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key S-ELISA,ELISA
Immunogen Prot. Seq GHSNHIALYAAVRALHSEGKLPKGCSVLTLQSVNVLRKYISLLDLPLSLLHTQDVLFVLNSKEVAQAKKAMSCHRSQLLWFRRLYIIFSRYMRINSLSFL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PIGL (NP_004269, 153 a.a. ~ 252 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9487
Clone Number 2B6
Iso type IgG2b Kappa

Enviar un mensaje


PIGL monoclonal antibody (M01), clone 2B6

PIGL monoclonal antibody (M01), clone 2B6