ROCK2 monoclonal antibody (M02), clone 1E12 Ver mas grande

ROCK2 monoclonal antibody (M02), clone 1E12

AB-H00009475-M02

Producto nuevo

ROCK2 monoclonal antibody (M02), clone 1E12

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.


Hoja técnica

Size 100 ug
Gene Name ROCK2
Gene Alias KIAA0619
Gene Description Rho-associated, coiled-coil containing protein kinase 2
Storage Conditions Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,IHC-P,S-ELISA,ELISA,IF
Immunogen Prot. Seq KPLWHMFKPPPALECRRCHIKCHKDHMDKKEEIIAPCKVYYDISTAKNLLLLANSTEEQQKWVSRLVKKIPKKPPAPDPFARSSPRTSMKIQQNQSIRRPSRQLAPNKPS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ROCK2 (NP_004841, 1279 a.a. ~ 1388 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9475
Clone Number 1E12
Iso type IgG1 Kappa

Más información

Mouse monoclonal antibody raised against a partial recombinant ROCK2.

Consulta sobre un producto

ROCK2 monoclonal antibody (M02), clone 1E12

ROCK2 monoclonal antibody (M02), clone 1E12