C1orf38 monoclonal antibody (M01), clone 1C3
  • C1orf38 monoclonal antibody (M01), clone 1C3

C1orf38 monoclonal antibody (M01), clone 1C3

Ref: AB-H00009473-M01
C1orf38 monoclonal antibody (M01), clone 1C3

Información del producto

Mouse monoclonal antibody raised against a full length recombinant C1orf38.
Información adicional
Size 100 ug
Gene Name C1orf38
Gene Alias ICB-1
Gene Description chromosome 1 open reading frame 38
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key S-ELISA,ELISA
Immunogen Prot. Seq MEGQQVILHLPLSQKGPFWTWEPSAPRTLLQVLQDPALKDLVLTCPTLPWHSLILRPQYEIQAIMHIFSSLRIAATRSAAQTQGEDLARVHQGWLQYVQQDSCPQEGPQAR
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen C1orf38 (AAH31655, 1 a.a. ~ 111 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9473
Clone Number 1C3
Iso type IgG1 Kappa

Enviar un mensaje


C1orf38 monoclonal antibody (M01), clone 1C3

C1orf38 monoclonal antibody (M01), clone 1C3