AKAP6 monoclonal antibody (M07), clone 2E8
  • AKAP6 monoclonal antibody (M07), clone 2E8

AKAP6 monoclonal antibody (M07), clone 2E8

Ref: AB-H00009472-M07
AKAP6 monoclonal antibody (M07), clone 2E8

Información del producto

Mouse monoclonal antibody raised against a partial recombinant AKAP6.
Información adicional
Size 100 ug
Gene Name AKAP6
Gene Alias ADAP100|ADAP6|AKAP100|KIAA0311|MGC165020|PRKA6|mAKAP
Gene Description A kinase (PRKA) anchor protein 6
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq RAEVGKEVNGLPQTSSGCAENLEFTPSKLDSEKESSGKPGESGMPEEHNAASAKSKVQDLSLKANQPTDKAALHPSPKTLTCEENLLNLHEKRHRNMH
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen AKAP6 (NP_004265.3, 2221 a.a. ~ 2318 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9472
Clone Number 2E8
Iso type IgG2b Kappa

Enviar un mensaje


AKAP6 monoclonal antibody (M07), clone 2E8

AKAP6 monoclonal antibody (M07), clone 2E8