PCYT1B purified MaxPab rabbit polyclonal antibody (D01P)
  • PCYT1B purified MaxPab rabbit polyclonal antibody (D01P)

PCYT1B purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00009468-D01P
PCYT1B purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human PCYT1B protein.
Información adicional
Size 100 ug
Gene Name PCYT1B
Gene Alias CCT-beta|CTB
Gene Description phosphate cytidylyltransferase 1, choline, beta
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Ce,WB-Tr
Immunogen Prot. Seq MPVVTTDAESETGIPKSLSNEPPSETMEEIEHTCPQPRLTLTAPAPFADETNCQCQAPHEKLTIAQARLGTPADRPVRVYADGIFDLFHSGHARALMQAKTLFPNSYLLVGVCSDDLTHKFKGFTVMNEAERYEALRHCRYVDEVIRDAPWTLTPEFLEKHKIDFVAHDDIPYSSAGSDDVYKHIKEAGMFVPTQRTEGISTSDIITRIVRDYDVYARRNLQRGYTAKELNVSFINEKRYRFQNQVDKMKEKVKN
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PCYT1B (NP_004836.2, 1 a.a. ~ 369 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9468

Enviar un mensaje


PCYT1B purified MaxPab rabbit polyclonal antibody (D01P)

PCYT1B purified MaxPab rabbit polyclonal antibody (D01P)