PCYT1B polyclonal antibody (A01)
  • PCYT1B polyclonal antibody (A01)

PCYT1B polyclonal antibody (A01)

Ref: AB-H00009468-A01
PCYT1B polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant PCYT1B.
Información adicional
Size 50 uL
Gene Name PCYT1B
Gene Alias CCT-beta|CTB
Gene Description phosphate cytidylyltransferase 1, choline, beta
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq NEKRYRFQNQVDKMKEKVKNVEERSKEFVNRVEEKSHDLIQKWEEKSREFIGNFLELFGPDGAWKQMFQERSSRMLQAL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PCYT1B (NP_004836, 236 a.a. ~ 314 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 9468

Enviar un mensaje


PCYT1B polyclonal antibody (A01)

PCYT1B polyclonal antibody (A01)