IL27RA monoclonal antibody (M01), clone 8G9
  • IL27RA monoclonal antibody (M01), clone 8G9

IL27RA monoclonal antibody (M01), clone 8G9

Ref: AB-H00009466-M01
IL27RA monoclonal antibody (M01), clone 8G9

Información del producto

Mouse monoclonal antibody raised against a partial recombinant IL27RA.
Información adicional
Size 100 ug
Gene Name IL27RA
Gene Alias CRL1|IL27R|TCCR|WSX1|zcytor1
Gene Description interleukin 27 receptor, alpha
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq QGSAGPLQCYGVGPLGDLNCSWEPLGDLGAPSELHLQSQKYRSNKTQTVAVAAGRSWVAIPREQLTMSDKLLVWGTKAGQPLWPPVFVNLETQMKPNAPR
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen IL27RA (NP_004834, 33 a.a. ~ 132 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9466
Clone Number 8G9
Iso type IgG2b Kappa

Enviar un mensaje


IL27RA monoclonal antibody (M01), clone 8G9

IL27RA monoclonal antibody (M01), clone 8G9