PICK1 MaxPab rabbit polyclonal antibody (D01)
  • PICK1 MaxPab rabbit polyclonal antibody (D01)

PICK1 MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00009463-D01
PICK1 MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human PICK1 protein.
Información adicional
Size 100 uL
Gene Name PICK1
Gene Alias MGC15204|PICK|PRKCABP
Gene Description protein interacting with PRKCA 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key IP
Immunogen Prot. Seq MFADLDYDIEEDKLGIPTVPGKVTLQKDAQNLIGISIGGGAQYCPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQADPKQGMSLDIVLKKVKHRLVENMSSGTADALGLSRAILCNDGLVKRLEELERTAELYKGMTEHTKNLLRAFYELSQTHRAFGDVFSVIGVREPQPAASEAFVKFADAHRSIEKFGIRLLKTIKPMLTDLNTYLNKAIPDTRLTIKKYLD
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PICK1 (NP_036539.1, 1 a.a. ~ 415 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 9463

Enviar un mensaje


PICK1 MaxPab rabbit polyclonal antibody (D01)

PICK1 MaxPab rabbit polyclonal antibody (D01)