FHL5 purified MaxPab rabbit polyclonal antibody (D01P)
  • FHL5 purified MaxPab rabbit polyclonal antibody (D01P)

FHL5 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00009457-D01P
FHL5 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human FHL5 protein.
Información adicional
Size 100 ug
Gene Name FHL5
Gene Alias ACT|FLJ33049|KIAA0776|RP3-393D12.2|dJ393D12.2
Gene Description four and a half LIM domains 5
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MTTAHFYCQYCTASLLGKKYVLKDDSPYCVTCYDRVFSNYCEECKKPIESDSKDLCYKDRHWHEGCFKCTKCNHSLVEKPFAAKDERLLCTECYSNECSSKCFHCKRTIMPGSRKMEFKGNYWHETCFVCENCRQPIGTKPLISKESGNYCVPCFEKEFAHYCNFCKKVITSGGITFCDQLWHKECFLCSDCRKDLCEEQFMSRDDYPFCMDCYNHLYANKCVACSKPISGLTGAKFICFQDSQWHSECFNCGKC
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen FHL5 (AAH21723.1, 1 a.a. ~ 284 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9457

Enviar un mensaje


FHL5 purified MaxPab rabbit polyclonal antibody (D01P)

FHL5 purified MaxPab rabbit polyclonal antibody (D01P)