MAP4K4 monoclonal antibody (M04), clone 4F8
  • MAP4K4 monoclonal antibody (M04), clone 4F8

MAP4K4 monoclonal antibody (M04), clone 4F8

Ref: AB-H00009448-M04
MAP4K4 monoclonal antibody (M04), clone 4F8

Información del producto

Mouse monoclonal antibody raised against a partial recombinant MAP4K4.
Información adicional
Size 100 ug
Gene Name MAP4K4
Gene Alias FLH21957|FLJ10410|FLJ20373|FLJ90111|HGK|KIAA0687|NIK
Gene Description mitogen-activated protein kinase kinase kinase kinase 4
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq VHPALQRPAEPQVQWSHLASLKNNVSPVSRSHSFSDPSPKFAHHHLRSQDPCPPSRSEVLSQSSDSKSEAPDPTQKAWSRSDSDEVPPRVPVRTTSRSPV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen MAP4K4 (NP_663719, 611 a.a. ~ 710 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9448
Clone Number 4F8
Iso type IgG1 Kappa

Enviar un mensaje


MAP4K4 monoclonal antibody (M04), clone 4F8

MAP4K4 monoclonal antibody (M04), clone 4F8