MAP4K4 polyclonal antibody (A01)
  • MAP4K4 polyclonal antibody (A01)

MAP4K4 polyclonal antibody (A01)

Ref: AB-H00009448-A01
MAP4K4 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant MAP4K4.
Información adicional
Size 50 uL
Gene Name MAP4K4
Gene Alias FLH21957|FLJ10410|FLJ20373|FLJ90111|HGK|KIAA0687|NIK
Gene Description mitogen-activated protein kinase kinase kinase kinase 4
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq VHPALQRPAEPQVQWSHLASLKNNVSPVSRSHSFSDPSPKFAHHHLRSQDPCPPSRSEVLSQSSDSKSEAPDPTQKAWSRSDSDEVPPRVPVRTTSRSPV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen MAP4K4 (NP_663719, 611 a.a. ~ 710 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 9448

Enviar un mensaje


MAP4K4 polyclonal antibody (A01)

MAP4K4 polyclonal antibody (A01)