Ver mas grande
GSTO1 monoclonal antibody (M01), clone 3D9
AB-H00009446-M01
Producto nuevo
GSTO1 monoclonal antibody (M01), clone 3D9
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 100 ug |
| Gene Name | GSTO1 |
| Gene Alias | DKFZp686H13163|GSTTLp28|P28 |
| Gene Description | glutathione S-transferase omega 1 |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Re,IP,S-ELISA,ELISA |
| Immunogen Prot. Seq | SKVPSLVGSFIRSQNKEDYAGLKEEFRKEFTKLEEVLTNKKTTFFGGNSISMIDYLIWPWFERLEAMKLNECVDHTPKLKLWMAAMKED |
| Antigen species Target species | Human |
| Quality control testing | Antibody Reactive Against Recombinant Protein. |
| Immunogen | GSTO1 (NP_004823, 121 a.a. ~ 209 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Storage Buffer | In 1x PBS, pH 7.4 |
| Gene ID | 9446 |
| Clone Number | 3D9 |
| Iso type | IgG1 Kappa |
Más información
Mouse monoclonal antibody raised against a partial recombinant GSTO1.