GSTO1 polyclonal antibody (A01)
  • GSTO1 polyclonal antibody (A01)

GSTO1 polyclonal antibody (A01)

Ref: AB-H00009446-A01
GSTO1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant GSTO1.
Información adicional
Size 50 uL
Gene Name GSTO1
Gene Alias DKFZp686H13163|GSTTLp28|P28
Gene Description glutathione S-transferase omega 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,WB-Re,ELISA
Immunogen Prot. Seq SKVPSLVGSFIRSQNKEDYAGLKEEFRKEFTKLEEVLTNKKTTFFGGNSISMIDYLIWPWFERLEAMKLNECVDHTPKLKLWMAAMKED
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen GSTO1 (NP_004823, 121 a.a. ~ 209 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 9446

Enviar un mensaje


GSTO1 polyclonal antibody (A01)

GSTO1 polyclonal antibody (A01)