QKI purified MaxPab mouse polyclonal antibody (B01P)
  • QKI purified MaxPab mouse polyclonal antibody (B01P)

QKI purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00009444-B01P
QKI purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human QKI protein.
Información adicional
Size 50 ug
Gene Name QKI
Gene Alias DKFZp586I0923|Hqk|QK|QK1|QK3
Gene Description quaking homolog, KH domain RNA binding (mouse)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MVGEMETKEKPKPTPDYLMQLMNDKKLMSSLPNFCGIFNHLERLLDEEISRVRKDMYNDTLNGSTEKRSAELPDAVGPIVQLQEKLYVPVKEYPDFNFVGRILGPRGLTAKQLEAETGCKIMVRGKGSMRDKKKEEQNRGKPNWEHLNEDLHVLITVEDAQNRAEIKLKRAVEEVKKLLVPAAEGEDSLKKMQLMELAILNGTYRDANIKSPALAFSLAATAQAAPRIITGPAPVLPPAALRTPTPAGPTIMPLI
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen QKI (NP_996735, 1 a.a. ~ 319 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9444

Enviar un mensaje


QKI purified MaxPab mouse polyclonal antibody (B01P)

QKI purified MaxPab mouse polyclonal antibody (B01P)