CRSP6 polyclonal antibody (A01)
  • CRSP6 polyclonal antibody (A01)

CRSP6 polyclonal antibody (A01)

Ref: AB-H00009440-A01
CRSP6 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant CRSP6.
Información adicional
Size 50 uL
Gene Name MED17
Gene Alias CRSP6|CRSP77|DRIP80|FLJ10812|TRAP80
Gene Description mediator complex subunit 17
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq FSNHVGLGPIESIGNASAITVASPSGDYAISVRNGPESGSKIMVQFPRNQCKDLPKSDVLQDNKWSHLRGPFKEVQWNKMEGRNFVYKMELLMSALSPCLL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CRSP6 (AAH21101, 551 a.a. ~ 651 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 9440

Enviar un mensaje


CRSP6 polyclonal antibody (A01)

CRSP6 polyclonal antibody (A01)