NCR1 purified MaxPab mouse polyclonal antibody (B01P)
  • NCR1 purified MaxPab mouse polyclonal antibody (B01P)

NCR1 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00009437-B01P
NCR1 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human NCR1 protein.
Información adicional
Size 50 ug
Gene Name NCR1
Gene Alias CD335|LY94|NK-p46|NKP46
Gene Description natural cytotoxicity triggering receptor 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq QQQTLPKPFIWAEPHFMVPKEKQVTICCQGNYGAVEYQLHFEGSLFAVDRPKPPERINKVKFYIPDMNSRMAGQYSCIYRVGELWSEPSNLLDLVVTEMYDTPTLSVHPGPEVISGEKVTFYCRLDTATSMFLLLKEGRSSHVQRGYGKVQAEFPLGPVTTAHRGTYRCFGSYNNHAWSFPSEPVKLLVTGDIENTSLAPEDPTFPDTWGTYLLTTETGLQKDHALWDHTAQNLLRMGLAFLVLVALVWFLVEDW
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen NCR1 (AAH64806, 22 a.a. ~ 303 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9437

Enviar un mensaje


NCR1 purified MaxPab mouse polyclonal antibody (B01P)

NCR1 purified MaxPab mouse polyclonal antibody (B01P)