GRAP2 MaxPab rabbit polyclonal antibody (D01)
  • GRAP2 MaxPab rabbit polyclonal antibody (D01)

GRAP2 MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00009402-D01
GRAP2 MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human GRAP2 protein.
Información adicional
Size 100 uL
Gene Name GRAP2
Gene Alias GADS|GRAP-2|GRB2L|GRBLG|GRID|GRPL|GrbX|Grf40|Mona|P38
Gene Description GRB2-related adaptor protein 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,IP
Immunogen Prot. Seq MEAVAKFDFTASGEDELSFHTGDVLKILSNQEEWFKAELGSQEGYVPKNFIDIQFPKWFHEGLSRHQAENLLMGKEVGFFIIRASQSSPGDFSISVRHEDDVQHFKVMRDNKGNYFLWTEKFPSLNKLVDYYRTNSISRQKQIFLRDRTREDQGHRGNSLDRRSQGGPHLSGAVGEEIRPSMNRKLSDHPPTLPLQQHQHQPQPPQYAPAPQQLQQPPQQRYLQHHHFHQERRGGSLDINDGHCGTGLGSEMNAA
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen GRAP2 (NP_004801.1, 1 a.a. ~ 330 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 9402

Enviar un mensaje


GRAP2 MaxPab rabbit polyclonal antibody (D01)

GRAP2 MaxPab rabbit polyclonal antibody (D01)