NMT2 purified MaxPab mouse polyclonal antibody (B01P)
  • NMT2 purified MaxPab mouse polyclonal antibody (B01P)

NMT2 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00009397-B01P
NMT2 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human NMT2 protein.
Información adicional
Size 50 ug
Gene Name NMT2
Gene Alias -
Gene Description N-myristoyltransferase 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MAEDSESAASQQSLELDDQDTCGIDGDNEEETEHAKGSPGGYLGAKKKKKKQKRKKEKPNSGGTKSDSASDSQEIKIQQPSKNPSVPMQKLQDIQRAMELLSACQGPARNIDEAAKHRYQFWDTQPVPKLDEVITSHGAIEPDKDNVRQEPYSLPQGFMWDTLDLSDAEVLKELYTLLNENYVEDDDNMFRFDYSPEFLLWALRPPGWLLQWHCGVRVSSNKKLVGFISAIPANIRIYDSVKKMVEINFLCVHKK
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen NMT2 (AAH06376.1, 1 a.a. ~ 498 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9397

Enviar un mensaje


NMT2 purified MaxPab mouse polyclonal antibody (B01P)

NMT2 purified MaxPab mouse polyclonal antibody (B01P)