LIPG purified MaxPab rabbit polyclonal antibody (D01P)
  • LIPG purified MaxPab rabbit polyclonal antibody (D01P)

LIPG purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00009388-D01P
LIPG purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human LIPG protein.
Información adicional
Size 100 ug
Gene Name LIPG
Gene Alias EDL|EL|PRO719
Gene Description lipase, endothelial
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MSNSVPLLCFWSLCYCFAAGSPVPFGPEGRLEDKLHKPKATQTEVKPSVRFNLRTSKDPEHEGCYLSVGHSQPLEDCSFNMTAKTFFIIHGWTMSGIFENWLHKLVSALHTREKDANVVVVDWLPLAHQLYTDAVNNTRVVGHSIARMLDWLQEKDDFSLGNVHLIGYSLGAHVAGYAGNFVKGTVGRITGLDPAGPMFEGADIHKRLSPDDADFVDVLHTYTRSFGLSIGIQMPVGHIDIYPNGGDFQPGCGLN
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen LIPG (AAH60825.1, 1 a.a. ~ 500 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9388

Enviar un mensaje


LIPG purified MaxPab rabbit polyclonal antibody (D01P)

LIPG purified MaxPab rabbit polyclonal antibody (D01P)