LIPG polyclonal antibody (A01)
  • LIPG polyclonal antibody (A01)

LIPG polyclonal antibody (A01)

Ref: AB-H00009388-A01
LIPG polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant LIPG.
Información adicional
Size 50 uL
Gene Name LIPG
Gene Alias EDL|EL|PRO719
Gene Description lipase, endothelial
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq MKIHVFSYKNMGEIEPTFYVTLYGTNADSQTLPLEIVERIEQNATNTFLVYTEEDLGDLLKIQLTWEGASQSWYNLWKEFRSYLSQPRNPGRELNIRRIR
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen LIPG (NP_006024, 351 a.a. ~ 450 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 9388

Enviar un mensaje


LIPG polyclonal antibody (A01)

LIPG polyclonal antibody (A01)