SLC22A8 monoclonal antibody (M02), clone 3C11
  • SLC22A8 monoclonal antibody (M02), clone 3C11

SLC22A8 monoclonal antibody (M02), clone 3C11

Ref: AB-H00009376-M02
SLC22A8 monoclonal antibody (M02), clone 3C11

Información del producto

Mouse monoclonal antibody raised against a partial recombinant SLC22A8.
Información adicional
Size 100 ug
Gene Name SLC22A8
Gene Alias MGC24086|OAT3
Gene Description solute carrier family 22 (organic anion transporter), member 8
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,S-ELISA,ELISA
Immunogen Prot. Seq TPESIRWLVLSGKSSKALKILRRVAVFNGKKEEGERLSLEELKLNLQKEISLAKAKYTASDLFRIPMLRR
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SLC22A8 (NP_004245.2, 256 a.a. ~ 325 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9376
Clone Number 3C11
Iso type IgG2b Kappa

Enviar un mensaje


SLC22A8 monoclonal antibody (M02), clone 3C11

SLC22A8 monoclonal antibody (M02), clone 3C11