PLAA polyclonal antibody (A01)
  • PLAA polyclonal antibody (A01)

PLAA polyclonal antibody (A01)

Ref: AB-H00009373-A01
PLAA polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant PLAA.
Información adicional
Size 50 uL
Gene Name PLAA
Gene Alias DOA1|FLJ11281|FLJ12699|PLA2P|PLAP
Gene Description phospholipase A2-activating protein
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq KNIHIALATLALNYSVCFHKDHNIEGKAQCLSLISTILEVVQDLEATFRLLVALGTLISDDSNAVQLAKSLGVDSQIKKYSSVSEPAKVSECCRFILNLL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PLAA (NP_004244, 639 a.a. ~ 738 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 9373

Enviar un mensaje


PLAA polyclonal antibody (A01)

PLAA polyclonal antibody (A01)