RAB28 monoclonal antibody (M01), clone 2C6
  • RAB28 monoclonal antibody (M01), clone 2C6

RAB28 monoclonal antibody (M01), clone 2C6

Ref: AB-H00009364-M01
RAB28 monoclonal antibody (M01), clone 2C6

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant RAB28.
Información adicional
Size 100 ug
Gene Name RAB28
Gene Alias MGC41862
Gene Description RAB28, member RAS oncogene family
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MSDSEEESQDRQLKIVVLGDGASGKTSLTTCFAQETFGKQYKQTIGLDFFLRRITLPGNLNVTLQIWDIGGQTIGGKMLDKYIYGAQLIWSICEQ
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RAB28 (AAH18067, 1 a.a. ~ 95 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9364
Clone Number 2C6
Iso type IgG2a Kappa

Enviar un mensaje


RAB28 monoclonal antibody (M01), clone 2C6

RAB28 monoclonal antibody (M01), clone 2C6