RAB33A monoclonal antibody (M04), clone 8A11
  • RAB33A monoclonal antibody (M04), clone 8A11

RAB33A monoclonal antibody (M04), clone 8A11

Ref: AB-H00009363-M04
RAB33A monoclonal antibody (M04), clone 8A11

Información del producto

Mouse monoclonal antibody raised against a full length recombinant RAB33A.
Información adicional
Size 100 ug
Gene Name RAB33A
Gene Alias MGC1488|RabS10
Gene Description RAB33A, member RAS oncogene family
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MAQPILGHGSLQPASAAGLASLELDSSLDQYVQIRIFKIIVIGDSNVGKTCLTFRFCGGTFPDKTEATIGVDFREKTVEIEGEKIKVQVWDTAGQERFRKSMVEHYYRNVHAVVFVYDVTKMTSFTNLKMWIQECNGHAVPPLVPKVLVGNKCDLREQIQVPSNLALKFADAHNMLLFETSAKDPKESQNVESIFMCLACRLKAQKSLLYRDAERQQGKVQKLEFPQEANSKTSCPC
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RAB33A (AAH09996, 1 a.a. ~ 237 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9363
Clone Number 8A11
Iso type IgG2a Kappa

Enviar un mensaje


RAB33A monoclonal antibody (M04), clone 8A11

RAB33A monoclonal antibody (M04), clone 8A11