RAB33A purified MaxPab mouse polyclonal antibody (B01P)
  • RAB33A purified MaxPab mouse polyclonal antibody (B01P)

RAB33A purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00009363-B01P
RAB33A purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human RAB33A protein.
Información adicional
Size 50 ug
Gene Name RAB33A
Gene Alias MGC1488|RabS10
Gene Description RAB33A, member RAS oncogene family
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MAQPILGHGSLQPASAAGLASLELDSSLDQYVQIRIFKIIVIGDSNVGKTCLTFRFCGGTFPDKTEATIGVDFREKTVEIEGEKIKVQVWDTAGQERFRKSMVEHYYRNVHAVVFVYDVTKMTSFTNLKMWIQECNGHAVPPLVPKVLVGNKCDLREQIQVPSNLALKFADAHNMLLFETSAKDPKESQNVESIFMCLACRLKAQKSLLYRDAERQQGKVQKLEFPQEANSKTSCPC
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen RAB33A (NP_004785.1, 1 a.a. ~ 237 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9363

Enviar un mensaje


RAB33A purified MaxPab mouse polyclonal antibody (B01P)

RAB33A purified MaxPab mouse polyclonal antibody (B01P)