LONP1 monoclonal antibody (M01), clone 3B2
  • LONP1 monoclonal antibody (M01), clone 3B2

LONP1 monoclonal antibody (M01), clone 3B2

Ref: AB-H00009361-M01
LONP1 monoclonal antibody (M01), clone 3B2

Información del producto

Mouse monoclonal antibody raised against a partial recombinant LONP1.
Información adicional
Size 100 ug
Gene Name LONP1
Gene Alias LON|LONP|LonHS|MGC1498|PIM1|PRSS15|hLON
Gene Description lon peptidase 1, mitochondrial
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq YVAQEKLAIAERYLVPQARALCGLDESKAKLSSDVLTLLIKQYCRESGVRNLQKQVEKVLRKSAYKIVSGEAESVEVTPENLQDFVGKPVFTVERMYDVTP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen LONP1 (NP_004784.2, 661 a.a. ~ 761 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9361
Clone Number 3B2
Iso type IgG2a Kappa

Enviar un mensaje


LONP1 monoclonal antibody (M01), clone 3B2

LONP1 monoclonal antibody (M01), clone 3B2