CER1 monoclonal antibody (M04), clone 3E11
  • CER1 monoclonal antibody (M04), clone 3E11

CER1 monoclonal antibody (M04), clone 3E11

Ref: AB-H00009350-M04
CER1 monoclonal antibody (M04), clone 3E11

Información del producto

Mouse monoclonal antibody raised against a full length recombinant CER1.
Información adicional
Size 100 ug
Gene Name CER1
Gene Alias DAND4|MGC119894|MGC119895|MGC96951
Gene Description cerberus 1, cysteine knot superfamily, homolog (Xenopus laevis)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,IP,ELISA
Immunogen Prot. Seq HWETCRTVPFSQTITHEGCEKVVVQNNLCFGKCGSVHFPGAAQHSHTSCSHCLPAKFTTMHLPLNCTELSSVIKVVMLVEECQCKVKTEHEDGHILHAGSQDSFIPGVS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CER1 (NP_005445.1, 158 a.a. ~ 266 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9350
Clone Number 3E11
Iso type IgG2a Kappa

Enviar un mensaje


CER1 monoclonal antibody (M04), clone 3E11

CER1 monoclonal antibody (M04), clone 3E11