RPL23 monoclonal antibody (M01), clone 2F12
  • RPL23 monoclonal antibody (M01), clone 2F12

RPL23 monoclonal antibody (M01), clone 2F12

Ref: AB-H00009349-M01
RPL23 monoclonal antibody (M01), clone 2F12

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant RPL23.
Información adicional
Size 100 ug
Gene Name RPL23
Gene Alias MGC111167|MGC117346|MGC72008|rpL17
Gene Description ribosomal protein L23
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MSKRGRGGSSGAKFRISLGLPVGAVINCADNTGAKNLYIISVKGIKGRLNRLPAAGVGDMVMATVKKGKPELRKKGE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RPL23 (AAH34378, 1 a.a. ~ 77 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9349
Clone Number 2F12
Iso type IgG2b Kappa

Enviar un mensaje


RPL23 monoclonal antibody (M01), clone 2F12

RPL23 monoclonal antibody (M01), clone 2F12