SNAP29 polyclonal antibody (A01)
  • SNAP29 polyclonal antibody (A01)

SNAP29 polyclonal antibody (A01)

Ref: AB-H00009342-A01
SNAP29 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a full-length recombinant SNAP29.
Información adicional
Size 50 uL
Gene Name SNAP29
Gene Alias CEDNIK|FLJ21051|SNAP-29
Gene Description synaptosomal-associated protein, 29kDa
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MSAYPKSYNPFDDDGEDEGARPAPWRDARDLPDGPDAPADRQQYLRQEVLRRAEATAASTSRSLALMYESEKVGVASSEELARQRGVLERTEKMVDKMDQDLKISQKHINSIKSVFGGLVNYFKSKPVETPPEQNGTLTSQPNNRLKEAISTSKEQEAKYQASHPNLRKLDDTDPVPRGAGSAMSTDAYPKNPHLRAYHQKIDSNLDELSMGLGRLKDIALGMQTEIEEQDDILDRLTTKVDKLDVNIKSTERKV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SNAP29 (AAH09715, 1 a.a. ~ 258 a.a) full-length recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 9342

Enviar un mensaje


SNAP29 polyclonal antibody (A01)

SNAP29 polyclonal antibody (A01)