TCEAL1 purified MaxPab mouse polyclonal antibody (B01P)
  • TCEAL1 purified MaxPab mouse polyclonal antibody (B01P)

TCEAL1 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00009338-B01P
TCEAL1 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human TCEAL1 protein.
Información adicional
Size 50 ug
Gene Name TCEAL1
Gene Alias SIIR|p21|pp21
Gene Description transcription elongation factor A (SII)-like 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF
Immunogen Prot. Seq MDKPRKENEEEPQSAPKTDEERPPVEHSPEKQSPEEQSSEEQSSEEEFFPEELLPELLPEMLLSEERPPQEGLSRKDLFEGRPPMEQPPCGVGKHKLEEGSFKERLARSRPQFRGDIHGRNLSNEEMIQAADELEEMKRVRNKLMIMHWKAKRSRPYPI
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen TCEAL1 (NP_001006640.1, 1 a.a. ~ 159 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9338

Enviar un mensaje


TCEAL1 purified MaxPab mouse polyclonal antibody (B01P)

TCEAL1 purified MaxPab mouse polyclonal antibody (B01P)