TGM5 polyclonal antibody (A01)
  • TGM5 polyclonal antibody (A01)

TGM5 polyclonal antibody (A01)

Ref: AB-H00009333-A01
TGM5 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant TGM5.
Información adicional
Size 50 uL
Gene Name TGM5
Gene Alias MGC141907|TGM6|TGMX|TGX
Gene Description transglutaminase 5
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq FKLLDPPNMGQDICFVLLALNMSSQFKDLKVNLSAQSLLHDGSPLSPFWQDTAFITLSPKEAKTYPCKISYSQYSQYLSTDKLIRISALGEEKSSPEKIL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TGM5 (NP_963925, 511 a.a. ~ 610 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 9333

Enviar un mensaje


TGM5 polyclonal antibody (A01)

TGM5 polyclonal antibody (A01)