HMGN3 monoclonal antibody (M05A), clone 3E17
  • HMGN3 monoclonal antibody (M05A), clone 3E17

HMGN3 monoclonal antibody (M05A), clone 3E17

Ref: AB-H00009324-M05A
HMGN3 monoclonal antibody (M05A), clone 3E17

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant HMGN3.
Información adicional
Size 200 uL
Gene Name HMGN3
Gene Alias DKFZp686E20226|PNAS-24|PNAS-25|TRIP7
Gene Description high mobility group nucleosomal binding domain 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA
Immunogen Prot. Seq MPKRKSPENTEGKDGSKVTKQEPTRRSARLSAKPAPPKPEPKPRKTSAKKEPGAKISRGAKGKKEEKQEAGKEGTEN
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen HMGN3 (AAH09529, 1 a.a. ~ 77 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In ascites fluid
Gene ID 9324
Clone Number 3E17
Iso type IgM Kappa

Enviar un mensaje


HMGN3 monoclonal antibody (M05A), clone 3E17

HMGN3 monoclonal antibody (M05A), clone 3E17