KLF4 monoclonal antibody (M01A), clone 2F5
  • KLF4 monoclonal antibody (M01A), clone 2F5

KLF4 monoclonal antibody (M01A), clone 2F5

Ref: AB-H00009314-M01A
KLF4 monoclonal antibody (M01A), clone 2F5

Información del producto

Mouse monoclonal antibody raised against a partial recombinant KLF4.
Información adicional
Size 200 uL
Gene Name KLF4
Gene Alias EZF|GKLF
Gene Description Kruppel-like factor 4 (gut)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,ELISA
Immunogen Prot. Seq VLKASLSAPGSEYGSPSVISVSKGSPDGSHPVVVAPYNGGPPRTCPKIKQEAVSSCTHLGAGPPLSNGHRPAAHDFPLGRQLPSRTTPTLGLEEVLSSRD
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen KLF4 (AAH29923, 221 a.a. ~ 320 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In ascites fluid
Gene ID 9314
Clone Number 2F5
Iso type IgG

Enviar un mensaje


KLF4 monoclonal antibody (M01A), clone 2F5

KLF4 monoclonal antibody (M01A), clone 2F5