CD83 monoclonal antibody (M01), clone 3G10-1F4
  • CD83 monoclonal antibody (M01), clone 3G10-1F4

CD83 monoclonal antibody (M01), clone 3G10-1F4

Ref: AB-H00009308-M01
CD83 monoclonal antibody (M01), clone 3G10-1F4

Información del producto

Mouse monoclonal antibody raised against a full length recombinant CD83.
Información adicional
Size 100 ug
Gene Name CD83
Gene Alias BL11|HB15
Gene Description CD83 molecule
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr,WB-Re,IP,S-ELISA,ELISA
Immunogen Prot. Seq MSRGLQLLLLSCAYSLAPATPEVKVACSEDVDLPCTAPWDPQVPYTVSWVKLLEGGEERMETPQEDHLRGQHYHQKGQNGSFDAPNERPYSLKIRNTTSCNSGTYRCTLQDPDGQRNLSGKVILRVTGCPAQRKEETFKKYRAEIVLLLALVIFYLTLIIFTCKFARLQSIFPDFSKAGMERAFLPVTSPNKHLGLVTPHKTELV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CD83 (AAH30830, 1 a.a. ~ 205 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9308
Clone Number 3G10-1F4
Iso type IgG1 Kappa

Enviar un mensaje


CD83 monoclonal antibody (M01), clone 3G10-1F4

CD83 monoclonal antibody (M01), clone 3G10-1F4