CD83 purified MaxPab rabbit polyclonal antibody (D01P)
  • CD83 purified MaxPab rabbit polyclonal antibody (D01P)

CD83 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00009308-D01P
CD83 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human CD83 protein.
Información adicional
Size 100 ug
Gene Name CD83
Gene Alias BL11|HB15
Gene Description CD83 molecule
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MSRGLQLLLLSCAYSLAPATPEVKVACSEDVDLPCTAPWDPQVPYTVSWVKLLEGGEERMETPQEDHLRGQHYHQKGQNGSFDAPNERPYSLKIRNTTSCNSGTYRCTLQDPDGQRNLSGKVILRVTGCPAQRKEETFKKYRAEIVLLLALVIFYLTLIIFTCKFARLQSIFPDFSKAGMERAFLPVTSPNKHLGLVTPHKTELV
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CD83 (AAH30830.1, 1 a.a. ~ 205 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9308

Enviar un mensaje


CD83 purified MaxPab rabbit polyclonal antibody (D01P)

CD83 purified MaxPab rabbit polyclonal antibody (D01P)